Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182814 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TFDP2 antibody: synthetic peptide directed towards the N terminal of human TFDP2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAE
ATGWV PGDRKRARKF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
Korz C, Pscherer A, Benner A, Mertens D, Schaffner C, Leupolt E, Döhner H, Stilgenbauer S, Lichter P
Blood 2002 Jun 15;99(12):4554-61
Blood 2002 Jun 15;99(12):4554-61
No comments: Submit comment
No validations: Submit validation data