H00005606-M01A

MAP2K3 antibody from Abnova Corporation
MAPKK3, MEK3, MKK3, PRKMK3

Antibody data

Product number
H00005606-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005606-M01A, RRID:AB_1577144
Product name
MAP2K3 monoclonal antibody (M01A), clone 2F12
Provider product page
Abnova Corporation - H00005606-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAP2K3.
Antigen sequence
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPA
PNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL
GRGAYGVVEKVRHAQSGTIMAVKRIRATVN
Isotype
IgG
Antibody clone number
2F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -