Antibody data

Product number
H00009722-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009722-B01, RRID:AB_1138719
Product name
NOS1AP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009722-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOS1AP protein.
Antigen sequence
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAK
YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKK
KVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESK
MLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNI
FRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQH
TQQNADGQEDGESERNSNSSGDPGRQLTGAERAST
ATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGK
EGGSHTGSKVSHPQEPMLTASPRMLLPSSSSKPPG
LGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVH
LLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHIS
LLVKQVQELELKLSGQNAMGSQDSLLEITFRSGAL
PVLCDPTTPKPEDLHSPPLGAGLADFAHPAGSPLG
RRDCLVKLECFRFLPPEDTPPPAQGEALLGGLELI
KFRESGIASEYESNTDESEERDSWSQEELPRLLNV
LQRQELGDGLDDEIAV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -