HPA019713

NCS1 antibody from Atlas Antibodies
FREQ, NCS-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019713
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019713, RRID:AB_1854404
Product name
Anti-NCS1
Provider product page
Atlas Antibodies - HPA019713
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRV
DRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALS
LYDGLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -