HPA019713

NCS1 antibody from Sigma-Aldrich
FREQ, NCS-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019713
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019713, RRID:AB_1854404
Product name
Anti-FREQ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019713
Antibody type
Polyclonal
Antigen
Neuronal calcium sensor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRV
DRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALS
LYDGLV
Storage
-20C
Provider Type Product Number
- No reagents -