Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406619 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the N terminal of human PPP2R1A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWF
TSRTS ACGLFSVCYP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Heptad repeats regulate protein phosphatase 2a recruitment to I-kappaB kinase gamma/NF-kappaB essential modulator and are targeted by human T-lymphotropic virus type 1 tax.
Hong S, Wang LC, Gao X, Kuo YL, Liu B, Merling R, Kung HJ, Shih HM, Giam CZ
The Journal of biological chemistry 2007 Apr 20;282(16):12119-26
The Journal of biological chemistry 2007 Apr 20;282(16):12119-26
No comments: Submit comment
No validations: Submit validation data