H00006757-M01
antibody from Abnova Corporation
Targeting: SSX2
CT5.2a, HD21, HOM-MEL-40, MGC119055, MGC15364, MGC3884, SSX
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006757-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006757-M01, RRID:AB_1137050
- Product name
- SSX2 monoclonal antibody (M01), clone 1A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant SSX2.
- Antigen sequence
MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKE
EWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPF
MCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQ
GISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELC
PPGKPTTSEKIHERSGNREAQEKEERRGTAHRWSS
QNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGN
MPGPTDCVRENSW- Isotype
- IgG
- Antibody clone number
- 1A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SSX2-4 expression in early-stage non-small cell lung cancer.
Expression and immunotherapeutic targeting of the SSX family of cancer-testis antigens in prostate cancer.
Greve KB, Pøhl M, Olsen KE, Nielsen O, Ditzel HJ, Gjerstorff MF
Tissue antigens 2014 May;83(5):344-9
Tissue antigens 2014 May;83(5):344-9
Expression and immunotherapeutic targeting of the SSX family of cancer-testis antigens in prostate cancer.
Smith HA, Cronk RJ, Lang JM, McNeel DG
Cancer research 2011 Nov 1;71(21):6785-95
Cancer research 2011 Nov 1;71(21):6785-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SSX2 expression in transfected 293T cell line by SSX2 monoclonal antibody (M01), clone 1A4.Lane 1: SSX2 transfected lysate(25.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SSX2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SSX2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol