HPA000610

FAM47A antibody from Sigma-Aldrich
MGC27003
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000610
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000610, RRID:AB_1078805
Product name
Anti-FAM47A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000610
Antibody type
Polyclonal
Antigen
Protein FAM47A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EPCLQPPETQVSHPHPEHPKTRRRSSLHSQPPKTR
RTSSLRSEPPKTRRTSSLRSEPPKTRRTSSLGPEP
PKTRRVSSLRPELPKSRRVSSLHPEPPKAPESHQF
SEPPKIRASYIKELLQEDTPSTKECVSDSLQ
Storage
-20C
Provider Type Product Number
- No reagents -