Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002023-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002023-M01, RRID:AB_463881
- Product name
- ENO1 monoclonal antibody (M01), clone 8G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ENO1.
- Antigen sequence
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAV
PSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN
KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSK
FGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN
SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGA
ANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE
GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMD
VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY
KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQV
VGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLV
VGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK- Isotype
- IgG
- Antibody clone number
- 8G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The interaction of enolase-1 with caveolae-associated proteins regulates its subcellular localization.
Overexpression of α-enolase correlates with poor survival in canine mammary carcinoma.
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Diagnostic detection of human lung cancer-associated antigen using a gold nanoparticle-based electrochemical immunosensor.
Comparative proteomics analysis of Barrett metaplasia and esophageal adenocarcinoma using two-dimensional liquid mass mapping.
Zakrzewicz D, Didiasova M, Zakrzewicz A, Hocke AC, Uhle F, Markart P, Preissner KT, Wygrecka M
The Biochemical journal 2014 Jun 1;460(2):295-307
The Biochemical journal 2014 Jun 1;460(2):295-307
Overexpression of α-enolase correlates with poor survival in canine mammary carcinoma.
Chu PY, Hsu NC, Liao AT, Shih NY, Hou MF, Liu CH
BMC veterinary research 2011 Oct 21;7:62
BMC veterinary research 2011 Oct 21;7:62
Systematic proteomic analysis of human hepotacellular carcinoma cells reveals molecular pathways and networks involved in metastasis.
Yu Y, Shen H, Yu H, Zhong F, Zhang Y, Zhang C, Zhao J, Li H, Chen J, Liu Y, Yang P
Molecular bioSystems 2011 Jun;7(6):1908-16
Molecular bioSystems 2011 Jun;7(6):1908-16
Diagnostic detection of human lung cancer-associated antigen using a gold nanoparticle-based electrochemical immunosensor.
Ho JA, Chang HC, Shih NY, Wu LC, Chang YF, Chen CC, Chou C
Analytical chemistry 2010 Jul 15;82(14):5944-50
Analytical chemistry 2010 Jul 15;82(14):5944-50
Comparative proteomics analysis of Barrett metaplasia and esophageal adenocarcinoma using two-dimensional liquid mass mapping.
Zhao J, Chang AC, Li C, Shedden KA, Thomas DG, Misek DE, Manoharan AP, Giordano TJ, Beer DG, Lubman DM
Molecular & cellular proteomics : MCP 2007 Jun;6(6):987-99
Molecular & cellular proteomics : MCP 2007 Jun;6(6):987-99
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ENO1 monoclonal antibody (M01), clone 8G8 Western Blot analysis of ENO1 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ENO1 expression in transfected 293T cell line by ENO1 monoclonal antibody (M01), clone 8G8.Lane 1: ENO1 transfected lysate(47 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ENO1 monoclonal antibody (M01), clone 8G8. Western Blot analysis of ENO1 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ENO1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ENO1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ENO1 transfected lysate using anti-ENO1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ENO1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ENO1 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol