H00002023-M07A

ENO1 antibody from Abnova Corporation
ENO1L1, MBP-1, MPB1, PPH

Antibody data

Product number
H00002023-M07A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002023-M07A, RRID:AB_1574675
Product name
ENO1 monoclonal antibody (M07A), clone 8G3
Provider product page
Abnova Corporation - H00002023-M07A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ENO1.
Antigen sequence
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAV
PSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN
KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSK
FGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN
SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGA
ANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE
GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMD
VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY
KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQV
VGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLV
VGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK
Isotype
IgM
Antibody clone number
8G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -