Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182989 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Enolase 1, (Alpha) (ENO1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGS
KAKFA GRNFRNPLAK- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The lectin Helix pomatia agglutinin recognizes O-GlcNAc containing glycoproteins in human breast cancer.
c-myc Promoter-binding protein 1 (MBP-1) regulates prostate cancer cell growth by inhibiting MAPK pathway.
Rambaruth ND, Greenwell P, Dwek MV
Glycobiology 2012 Jun;22(6):839-48
Glycobiology 2012 Jun;22(6):839-48
c-myc Promoter-binding protein 1 (MBP-1) regulates prostate cancer cell growth by inhibiting MAPK pathway.
Ghosh AK, Steele R, Ray RB
The Journal of biological chemistry 2005 Apr 8;280(14):14325-30
The Journal of biological chemistry 2005 Apr 8;280(14):14325-30
No comments: Submit comment
No validations: Submit validation data