Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15708 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15708, RRID:AB_10676800
- Product name
- Scrib polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Scrib.
- Antigen sequence
ALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPS
PTPLEDFGLQTSASPGRLPLSGKKFDYRAFAALPS
SRPVYDIQSPDFVEELRTLEASPSPGSQEEDGEVA
LVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGP
VPS- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Feb 28;10(1):35-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Scrib polyclonal antibody (Cat # PAB15708).Lane 1 : Total lysate of HaloTag-fused Scrib expressed HEK293 cells (4 ug).Lane 2 : Control HEK293 cell lysate (4 ug).