HPA027726

PPP1R9A antibody from Atlas Antibodies
FLJ20068, KIAA1222, Neurabin-I
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027726
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027726, RRID:AB_1855653
Product name
Anti-PPP1R9A
Provider product page
Atlas Antibodies - HPA027726
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEPCAESKAMPKSEIPSPQSQLLEDAEANLVGREA
AKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFD
GSHVYMHSDYNVYRVRSRYNSDWGETGTEQDEEED
SDENSYYQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -