HPA017914

PPP1R9A antibody from Sigma-Aldrich
FLJ20068, KIAA1222, Neurabin-I
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017914, RRID:AB_1855654
Product name
Anti-PPP1R9A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017914
Antibody type
Polyclonal
Antigen
Neurabin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAIISEKAENNEYSVTGHYPLNLPSVTVTNLDTFG
HLKDSNSWPPSNKRGVDTEDAHKSNATPVPEVASK
STSLASIPGEEIQQSKEPEDSTSNQQTPD
Storage
-20C
Provider Type Product Number
- No reagents -