Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040220 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040220, RRID:AB_10961153
- Product name
- Anti-SPATC1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PPRTSSSPASVNDSRGPRTTEPSTKSMMEVERKLA
HRKTSKFPENPRESKQLAWERLVGEIAFQLDRRIL
SSI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues.
Andersson S, Nilsson K, Fagerberg L, Hallström BM, Sundström C, Danielsson A, Edlund K, Uhlen M, Asplund A
PloS one 2014;9(12):e115911
PloS one 2014;9(12):e115911
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach, lower shows strong membranous and cytoplasmic positivity in gastric parietal cells.