HPA027340

PDE7A antibody from Atlas Antibodies
HCP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027340
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027340, RRID:AB_1855127
Product name
Anti-PDE7A
Provider product page
Atlas Antibodies - HPA027340
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKAS
WKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -