H00005150-A01

PDE7A antibody from Abnova Corporation
HCP1
No application information provided.

Antibody data

Product number
H00005150-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005150-A01, RRID:AB_463565
Product name
PDE7A polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00005150-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant PDE7A.
Antigen sequence
TSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFE
SERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLS
FQRYLRSSRFFRGTAVSNSLNILDDDYNGQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -