HPA027340

PDE7A antibody from MilliporeSigma / Merck KGaA
HCP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027340
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027340, RRID:AB_1855127
Product name
Anti-PDE7A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027340
Antibody type
Polyclonal
Antigen
High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKAS
WKGLQREQSSSEDTDAAFELNSQLLPQENRLS
Storage
-20C
Provider Type Product Number
- No reagents -