HPA026425

AKR1B1 antibody from Sigma-Aldrich
ALDR1, AR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026425
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026425, RRID:AB_10601563
Product name
Anti-AKR1B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026425
Antibody type
Polyclonal
Antigen
aldo-keto reductase family 1, member B1 (aldose reductase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTG
FKPGKEFFPLDESGNV
Storage
-20C
Provider Type Product Number
- No reagents -