PAB24388
antibody from Abnova Corporation
		Targeting: OSER1
		
		C20orf111, dJ1183I21.1, HSPC207, Osr1, Perit1	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB24388 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#PAB24388, RRID:AB_11132732
 - Product name
 - C20orf111 polyclonal antibody
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against recombinant C20orf111.
 - Antigen sequence
 GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAP
ERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDD
VTIEDLSGYMEYYLYIPKKMS- Isotype
 - IgG
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with C20orf111 polyclonal antibody (Cat # PAB24388).
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human kidney with C20orf111 polyclonal antibody (Cat # PAB24388) shows moderate cytoplasmic and nuclear positivity in cells in tubules at 1:20-1:50 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)