HPA019141

INHA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019141, RRID:AB_1851789
Product name
Anti-INHA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019141
Antibody type
Polyclonal
Antigen
Inhibin alpha chain Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLD
RQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAP
PHWAVLHLAT
Storage
-20C
Provider Type Product Number
- No reagents -