ABIN634144

antibody from antibodies-online

Targeting: MCM2 BM28, CCNL1, cdc19, CDCL1, D3S3194, DFNA70, KIAA0030

Western blot

Antibody data

Submit

Validation data

Product number: ABIN634144 - Provider product page
Provider: antibodies-online
Product name: anti-Minichromosome Maintenance Complex Component 2 (MCM2) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MCM2 protein structure - ABIN634144 shown in red.