H00004171-M01
antibody from Abnova Corporation
Targeting: MCM2
BM28, CCNL1, cdc19, CDCL1, D3S3194, DFNA70, KIAA0030
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004171-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004171-M01, RRID:AB_490071
- Product name
- MCM2 monoclonal antibody (M01), clone 6A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MCM2.
- Antigen sequence
TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQL
VAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINI
HNLSAFYDSELFRMNKFSHDLKRKMILQQF- Isotype
- IgG
- Antibody clone number
- 6A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MCM2 monoclonal antibody (M01), clone 6A8 Western Blot analysis of MCM2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody (M01), clone 6A8.Lane 1: MCM2 transfected lysate(101.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MCM2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MCM2 transfected lysate using anti-MCM2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MCM2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol