HPA000567

MKRN1 antibody from Sigma-Aldrich
RNF61
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000567, RRID:AB_1079299
Product name
Anti-MKRNP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000567
Antibody type
Polyclonal
Antigen
Makorin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEHRFGILSNCNHTFCLKCIRKWRSAKEFESRIVK
SCPQCRITSNFVIPSEYWVEEKEEKQKLIQKYKEA
MSNKACKYFDEGRGSCPFGENCFYKHMYPDGRREE
PQRQQVGTSSRNPGQQRNHFWEFFEEGANSNPFDD
EEEAV
Storage
-20C
Provider Type Product Number
- No reagents -