Antibody data

Product number
ABIN616962
Provider
antibodies-online
Product name
anti-Islet Amyloid Polypeptide (IAPP) (N-Term) antibody
Provider product page
antibodies-online - ABIN616962
Antibody type
Polyclonal
Antigen
The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP
Reactivity
Human
Host
Rabbit
Antigen sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKC
NTATC ATQRLANFLV
Vial size
50 µg
Provider Type Product Number
- No reagents -