H00002353-M65

FOS antibody from Abnova Corporation
AP-1, c-fos

Antibody data

Product number
H00002353-M65
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002353-M65, RRID:AB_11188230
Product name
FOS monoclonal antibody (M65), clone 2D12
Provider product page
Abnova Corporation - H00002353-M65
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FOS.
Antigen sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPAD
SFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTS
PDLQWLVQPALVSSVAPSQTRAPHPFGVPA
Isotype
IgG
Antibody clone number
2D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -