Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026680 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TSHR
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RADLSYPSHCCAFKNQKKIRGILESLMCNESSMQS
LRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKF
QDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETL
QAFDSHYDYTICGDSEDMVCTPKSDEFNPC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Abrogation of self-tolerance by misfolded self-antigens complexed with MHC class II molecules
Liver X receptor β controls thyroid hormone feedback in the brain and regulates browning of subcutaneous white adipose tissue
Jin H, Kishida K, Arase N, Matsuoka S, Nakai W, Kohyama M, Suenaga T, Yamamoto K, Sasazuki T, Arase H
Science Advances 2022;8(9)
Science Advances 2022;8(9)
Liver X receptor β controls thyroid hormone feedback in the brain and regulates browning of subcutaneous white adipose tissue
Miao Y, Wu W, Dai Y, Maneix L, Huang B, Warner M, Gustafsson J
Proceedings of the National Academy of Sciences 2015;112(45):14006-14011
Proceedings of the National Academy of Sciences 2015;112(45):14006-14011
No comments: Submit comment
No validations: Submit validation data