Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502163 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Thyroid Stimulating Hormone Receptor (TSHR) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLT
VIDKD AFGGVYSGPS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Thyroid hormone independent associations between serum TSH levels and indicators of bone turnover in cured patients with differentiated thyroid carcinoma.
Heemstra KA, van der Deure WM, Peeters RP, Hamdy NA, Stokkel MP, Corssmit EP, Romijn JA, Visser TJ, Smit JW
European journal of endocrinology / European Federation of Endocrine Societies 2008 Jul;159(1):69-76
European journal of endocrinology / European Federation of Endocrine Societies 2008 Jul;159(1):69-76
No comments: Submit comment
No validations: Submit validation data