HPA026680

TSHR antibody from MilliporeSigma / Merck KGaA
LGR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026680
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA026680, RRID:AB_1857994
Product name
Anti-TSHR antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA026680
Antibody type
Polyclonal
Antigen
Thyrotropin receptor Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RADLSYPSHCCAFKNQKKIRGILESLMCNESSMQS
LRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKF
QDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETL
QAFDSHYDYTICGDSEDMVCTPKSDEFNPC
Storage
-20C
Provider Type Product Number
- No reagents -