HPA001039

SLITRK4 antibody from Sigma-Aldrich
DKFZp547M2010
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001039
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001039, RRID:AB_1080019
Product name
Anti-SLITRK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001039
Antibody type
Polyclonal
Antigen
SLIT and NTRK-like protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQ
MSKSHACGLKESETGFMFSDPPGQKVVMRNVADKE
KDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFL
ESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGN
HS
Storage
-20C
Provider Type Product Number
- No reagents -