HPA043458

C4orf19 antibody from Atlas Antibodies
FLJ11017
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043458
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043458, RRID:AB_10960696
Product name
Anti-C4orf19
Provider product page
Atlas Antibodies - HPA043458
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQK
NDPQRQGSKKTESSSRTADPWEPCWPHQGPLPQGD
AGGEHHACGVNGIGPAATPQPTGNSSPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -