HPA060508

ZSWIM3 antibody from Atlas Antibodies
C20orf164, dJ337O18.7, PPP1R174

Antibody data

Product number
HPA060508
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060508, RRID:AB_2684297
Product name
Anti-ZSWIM3
Provider product page
Atlas Antibodies - HPA060508
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RGMVPNTGQPEKQGRNDMIQDLSRELANLLMQTEG
PELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKD
VGRLPFLWGKQEEGEGFPPATA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -