Antibody data

Product number
H00010744-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010744-B01, RRID:AB_1579419
Product name
PTTG2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00010744-B01
Antibody type
Polyclonal
Antigen
PTTG2 (NP_006598.1, 1 a.a. ~ 191 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKAL
DGISQVLTPRFGKTYDAPSALPKATRKALGTVNRA
TEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVP
ASDDAYPEIEKFFPFNLLDFESFDLPEERQIAHLP
LSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWE
CNLFAVSFKHSVDPGC
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -