Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183369 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Gap Junction Protein, alpha 1, 43kDa (GJA1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GJA1 antibody: synthetic peptide directed towards the N terminal of human GJA1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDM
HLKQI EIKKFKYGIE- Vial size
- 50 µg
Submitted references Connexin43 interacts with NOV: a possible mechanism for negative regulation of cell growth in choriocarcinoma cells.
Gellhaus A, Dong X, Propson S, Maass K, Klein-Hitpass L, Kibschull M, Traub O, Willecke K, Perbal B, Lye SJ, Winterhager E
The Journal of biological chemistry 2004 Aug 27;279(35):36931-42
The Journal of biological chemistry 2004 Aug 27;279(35):36931-42
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Species+tissue/cell type: Total rat cardiac lysate1:8 μg total cardiac lysate2: 15 μg total cardiac lysate3: 0 μg total cardiac lysate4: 0 μg total cardiac lysate Primary Antibody dilution:.25 μg/mL
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 μg/mL ELISA Titer: 1:.12500 Positive Control: Human Placenta
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-GJA1 Antibody Positive Control: Lane1:641 μg rat stiatum Primary Antibody Dilution: 1:0000Secondary Antibody: Goat anti-rabbit-IRDye800Secondry Antibody Dilution: 1:00,000Submitted by: Ruben van Vugt, The Nijmegen Centre for Molecular Life Sciences (NCMLS)