Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502241 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myosin Heavy Chain 1, Skeletal Muscle, Adult (MYH1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGAT
VTVKD DQVFPMNPPK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The role of MYH gene in genetic predisposition to colorectal cancer: another piece of the puzzle.
Avezzù A, Agostini M, Pucciarelli S, Lise M, Urso ED, Mammi I, Maretto I, Enzo MV, Pastrello C, Lise M, Nitti D, Viel A
Cancer letters 2008 Sep 18;268(2):308-13
Cancer letters 2008 Sep 18;268(2):308-13
No comments: Submit comment
No validations: Submit validation data