HPA022483

TPH1 antibody from Sigma-Aldrich
TPH, TPRH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022483
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022483, RRID:AB_1858378
Product name
Anti-TPH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022483
Antibody type
Polyclonal
Antigen
Tryptophan 5-hydroxylase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISELKHALSGHAKVKPFDPKITCKQECLITTFQDV
YFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRS
IQILKDTKSITSAMNELQHDLDVVSDALAKVSRKP
SI
Storage
-20C
Provider Type Product Number
- No reagents -