WH0010383M2

TUBB4B antibody from Sigma-Aldrich
Beta2, TUBB2C
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0010383M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0010383M2, RRID:AB_1844091
Product name
Monoclonal Anti-TUBB2C antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0010383M2
Antibody type
Monoclonal
Antigen
TUBB2 (AAH01911, a.a. 1-446) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGT
YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEP
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
YTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKV
SDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQ
LNADLRKLAV (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -