Antibody data

Product number
H00010383-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010383-M02, RRID:AB_463932
Product name
TUBB4B monoclonal antibody (M02), clone 1G3
Provider product page
Abnova Corporation - H00010383-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant TUBB4B.
Antigen sequence
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGT
YHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEP
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
YTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKV
SDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQ
LNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAA
VFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQF
TAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
Isotype
IgG
Antibody clone number
1G3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -