PAB29563
antibody from Abnova Corporation
Targeting: FGFR2
BEK, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29563 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FGFR2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human FGFR2.
- Antigen sequence
PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISW
TKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYAC
TASRTVDSETWYFMV- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4 cells, Lane 2: U-251MG sp cells, Lane 3: Human plasma (IgG/HSA depleted) with FGFR2 polyclonal antibody (Cat # PAB29563).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach shows strong cytoplasmic positivity in parietal cells with FGFR2 polyclonal antibody (Cat # PAB29563) at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)