Explore
Validate
LearnH00002263-M01
antibody from Abnova Corporation
Targeting: FGFR2
BEK, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002263-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002263-M01, RRID:AB_463955
- Product name
- FGFR2 monoclonal antibody (M01), clone 1G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FGFR2.
- Antigen sequence
GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQL
VEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRS
SCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT- Isotype
- IgG
- Antibody clone number
- 1G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Epithelial-mesenchymal transition confers resistance to selective FGFR inhibitors in SNU-16 gastric cancer cells.
Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity.
Low prognostic implication of fibroblast growth factor family activation in triple-negative breast cancer subsets.
Upregulation of ANGPTL4 messenger RNA and protein in severely calcified carotid plaques.
Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer.
The expression of fibroblast growth factor receptors during early bovine conceptus development and pharmacological analysis of their actions on trophoblast growth in vitro.
Grygielewicz P, Dymek B, Bujak A, Gunerka P, Stanczak A, Lamparska-Przybysz M, Wieczorek M, Dzwonek K, Zdzalik D
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association 2016 Jan;19(1):53-62
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association 2016 Jan;19(1):53-62
Mannose phosphate isomerase regulates fibroblast growth factor receptor family signaling and glioma radiosensitivity.
Cazet A, Charest J, Bennett DC, Sambrooks CL, Contessa JN
PloS one 2014;9(10):e110345
PloS one 2014;9(10):e110345
Low prognostic implication of fibroblast growth factor family activation in triple-negative breast cancer subsets.
Lee HJ, Seo AN, Park SY, Kim JY, Park JY, Yu JH, Ahn JH, Gong G
Annals of surgical oncology 2014 May;21(5):1561-8
Annals of surgical oncology 2014 May;21(5):1561-8
Upregulation of ANGPTL4 messenger RNA and protein in severely calcified carotid plaques.
Katano H, Yamada K
Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association 2014 May-Jun;23(5):933-47
Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association 2014 May-Jun;23(5):933-47
Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer.
Vermeulen JF, Kornegoor R, van der Wall E, van der Groep P, van Diest PJ
PloS one 2013;8(1):e53353
PloS one 2013;8(1):e53353
The expression of fibroblast growth factor receptors during early bovine conceptus development and pharmacological analysis of their actions on trophoblast growth in vitro.
Ozawa M, Yang QE, Ealy AD
Reproduction (Cambridge, England) 2013 Feb;145(2):191-201
Reproduction (Cambridge, England) 2013 Feb;145(2):191-201
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FGFR2 expression in transfected 293T cell line by FGFR2 monoclonal antibody (M01), clone 1G3.Lane 1: FGFR2 transfected lysate (Predicted MW: 92 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FGFR2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FGFR2 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
