H00002982-B01

GUCY1A1 antibody from Abnova Corporation
GC-SA3, GUC1A3, GUCY1A3

Antibody data

Product number
H00002982-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002982-B01, RRID:AB_1138410
Product name
GUCY1A3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00002982-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GUCY1A3 protein.
Antigen sequence
MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAG
SSESCKATMPICQDIPEKNIQESLPQRKTSRSRVY
LHTLAESICKLIFPEFERLNVALQRTLAKHKIKES
RKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSH
CQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT
TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCS
EFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS
LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQ
GKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV
RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSP
CVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLC
SIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF
TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKV
ETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELS
DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYC
LFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP
GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTN
SKPCFQKKDVEDGNANFLGKASGID
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -