HPA020870

GUCY1B1 antibody from Atlas Antibodies
GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020870
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020870, RRID:AB_1850444
Product name
Anti-GUCY1B3
Provider product page
Atlas Antibodies - HPA020870
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRI
IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFV
FCQESGYDTILRVLGSNVREFLQNLDALHDHLATI
YPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIV
IGII
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -