HPA023138

NEFM antibody from Atlas Antibodies
NEF3, NF-M, NFM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023138
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023138, RRID:AB_1854398
Product name
Anti-NEFM
Provider product page
Atlas Antibodies - HPA023138
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDA
YDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHR
LKERFEEEARLRDDTEAAIRALRKDIEEASLVKVE
LDKKVQSLQDEVAFLRSNH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -