HPA023138

NEFM antibody from Sigma-Aldrich
NEF3, NF-M, NFM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023138, RRID:AB_1854398
Product name
Anti-NEF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023138
Antibody type
Polyclonal
Antigen
Neurofilament medium polypeptide recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDA
YDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHR
LKERFEEEARLRDDTEAAIRALRKDIEEASLVKVE
LDKKVQSLQDEVAFLRSNH
Storage
-20C
Provider Type Product Number
- No reagents -