Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001032-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001032-M08, RRID:AB_1136911
- Product name
- CDKN2D monoclonal antibody (M08), clone 2E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant CDKN2D.
- Antigen sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHP
DALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQ
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDG
TGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL
TPLELALQRGAQDLVDILQGHMVAPL- Isotype
- IgG
- Antibody clone number
- 2E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10.Lane 1: CDKN2D transfected lysate(17.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDKN2D is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CDKN2D transfected lysate using anti-CDKN2D monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CDKN2D MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol