Antibody data

Product number
H00001032-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001032-M08, RRID:AB_1136911
Product name
CDKN2D monoclonal antibody (M08), clone 2E10
Provider product page
Abnova Corporation - H00001032-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CDKN2D.
Antigen sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHP
DALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQ
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDG
TGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL
TPLELALQRGAQDLVDILQGHMVAPL
Isotype
IgG
Antibody clone number
2E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -