R32207
antibody from NSJ Bioreagents
Targeting: PTP4A2
HU-PP-1, OV-1, PRL-2, PRL2, ptp-IV1a, PTP4A, PTPCAAX2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
- Flow cytometry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32207 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- PTP4A2 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the PTP4A2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat skeletal muscle, 2) rat thymus, 3) mouse brain, 4) mouse thymus, 5) human 22RV1, and 6) human MCF7 lysate with PTP4A2 antibody. Expected/observed molecular weight ~19 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human A431 cells with PTP4A2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human U937 cells with PTP4A2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human PC-3 cells with PTP4A2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.