HPA022997

FXR2 antibody from Atlas Antibodies
FMR1L2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA022997
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022997, RRID:AB_1849208
Product name
Anti-FXR2
Provider product page
Atlas Antibodies - HPA022997
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYST
DESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPS
SDVSTAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -