HPA022997

FXR2 antibody from Sigma-Aldrich
FMR1L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022997, RRID:AB_1849208
Product name
Anti-FXR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022997
Antibody type
Polyclonal
Antigen
Fragile X mental retardation syndrome-related protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYST
DESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPS
SDVSTAS
Storage
-20C
Provider Type Product Number
- No reagents -