Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001649-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001649-M01, RRID:AB_606131
- Product name
- DDIT3 monoclonal antibody (M01), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DDIT3.
- Antigen sequence
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENG
GTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEP
AEVTSTSQSPHSPDSSQSSL- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase (GNE) induces apoptotic processes in pancreatic carcinoma cells.
Kemmner W, Kessel P, Sanchez-Ruderisch H, Möller H, Hinderlich S, Schlag PM, Detjen K
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 Feb;26(2):938-46
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 Feb;26(2):938-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DDIT3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol