Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184281 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CCAAT/enhancer Binding Protein (C/EBP), zeta (CEBPZ) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CEBPZ antibody: synthetic peptide directed towards the N terminal of human CEBPZ
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSE
AENGF SLEEVLRLGG- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Physical interaction of tumour suppressor p53/p73 with CCAAT-binding transcription factor 2 (CTF2) and differential regulation of human high-mobility group 1 (HMG1) gene expression.
Uramoto H, Izumi H, Nagatani G, Ohmori H, Nagasue N, Ise T, Yoshida T, Yasumoto K, Kohno K
The Biochemical journal 2003 Apr 15;371(Pt 2):301-10
The Biochemical journal 2003 Apr 15;371(Pt 2):301-10
No comments: Submit comment
No validations: Submit validation data